PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g01540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 592aa    MW: 66406.4 Da    PI: 6.4034
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g01540genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.61.1e-23127227198
                EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv+a++L +gD +vF   + +++ l+
  Tp5g01540 127 FVKILTASDTSTHGGFSVLRKHATEClpaldmtQ--ATPTQELVTRDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVSAKRLVAGDAFVFL--RGENGDLR 222
                89****************************9543..445569************************************************..3488889* PP

                EEEE- CS
         B3  94 vkvfr 98 
                v+v+r
  Tp5g01540 223 VGVRR 227
                **998 PP

2Auxin_resp93.14.7e-31253332183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha+ t++ F v+Y+Pr   s+F+v v+k+++a+k+ +s+G+Rf+m+fe+e+s+er ++Gt+vg+ dl++ +Wp SkWrsL+
   Tp5g01540 253 ASHAVLTNTLFVVIYKPRI--SQFIVGVNKYMEAIKHGFSLGTRFRMRFEGEESPERIFTGTIVGTGDLSS-QWPASKWRSLQ 332
                 68999*************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.92E-40112256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.8E-38121241IPR015300DNA-binding pseudobarrel domain
CDDcd100172.59E-20125227No hitNo description
PROSITE profilePS5086312.139127229IPR003340B3 DNA binding domain
PfamPF023621.0E-21127227IPR003340B3 DNA binding domain
SMARTSM010193.7E-21127229IPR003340B3 DNA binding domain
PfamPF065071.1E-28253332IPR010525Auxin response factor
PfamPF023091.8E-13479572IPR033389AUX/IAA domain
SuperFamilySSF542771.11E-12484563No hitNo description
PROSITE profilePS5174526.365487579IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MANVDGDDFR TSLSRSYHDQ LYTELWKACA GPLVEVPLAE ERVFYFPQGH MEQLVASTNQ  60
GIESEEIPVF NLPPKILCRV LSVMLKAEHE TDEVYAQITL RPEEDQSEPT SLDPPIVEPT  120
KQMFHSFVKI LTASDTSTHG GFSVLRKHAT ECLPALDMTQ ATPTQELVTR DLHGFEWRFK  180
HIFRGQPRRH LLTTGWSTFV SAKRLVAGDA FVFLRGENGD LRVGVRRLAR HQSTMPTSVI  240
STQSMHLGVL ATASHAVLTN TLFVVIYKPR ISQFIVGVNK YMEAIKHGFS LGTRFRMRFE  300
GEESPERIFT GTIVGTGDLS SQWPASKWRS LQVQWDEPTT LQRPDKVSPW EIEPFLPTSP  360
VSTPAQQSQP KCKRSRPIES SVLTPAPASF LHGFPQSQDP ANASLKVFQD PSTERNLGGF  420
ATNNSFKAET PPPASCCYRL FGFDLTSNSP APVPPDNQPI DTSGSPKCQE PITPSAANEP  480
KKQQTSRTRT KVQMQGIAVG RAVDLTLLKS YDELIKELEE MFDIQGQLLS RDKWIVVFTD  540
DEGDMMLAGD DPWNEFCKMA KKIFIYSSDE VKKMTTKLKS SSSLQNEESM NW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1621935517355Auxin response factor 1
4ldw_A1e-1621935517355Auxin response factor 1
4ldv_A1e-1621935517355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3347170.0AF334717.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0597460.0AY059746.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0704630.0AY070463.1 Arabidopsis thaliana AT3g61830/F15G16_220 mRNA, complete cds.
GenBankAY0913920.0AY091392.1 Arabidopsis thaliana putative auxin response factor protein (At3g61830) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402437.10.0hypothetical protein EUTSA_v10005857mg
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLV4L0T80.0V4L0T8_EUTSA; Auxin response factor
STRINGAT3G61830.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18